PDB entry 5de9

View 5de9 on RCSB PDB site
Description: The role of Ile87 of CYP158A2 in oxidative coupling reaction
Class: oxidoreductase
Keywords: CYP158A2, Cytochrome P450, oxidative coupling reaction, OXIDOREDUCTASE
Deposited on 2015-08-25, released 2015-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Biflaviolin synthase CYP158A2
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: cyp158a2, SCO1207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FCA6 (Start-403)
      • conflict (86)
      • expression tag (404-405)
    Domains in SCOPe 2.07: d5de9a1, d5de9a2
  • Chain 'B':
    Compound: Biflaviolin synthase CYP158A2
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: cyp158a2, SCO1207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FCA6 (Start-403)
      • conflict (86)
      • expression tag (404-405)
    Domains in SCOPe 2.07: d5de9b1, d5de9b2
  • Heterogens: HEM, SPM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5de9A (A:)
    mteetisqavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddv
    rlvtndprfgreavmdrqvtrlaphfrpargavgfldppdhtrlrrsvaaaftargverv
    rersrgmldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlils
    sshgaevseraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllq
    iggeavtnnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialed
    veikgvriragdavyvsylaanrdpevfpdpdridferspnphvsfgfgphycpggmlar
    lesellvdavldrvpglklavapedvpfkkgalirgpealpvtwhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5de9A (A:)
    tisqavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddvrlvt
    ndprfgreavmdrqvtrlaphfrpargavgfldppdhtrlrrsvaaaftargvervrers
    rgmldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlilssshg
    aevseraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllqigge
    avtnnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialedveik
    gvriragdavyvsylaanrdpevfpdpdridferspnphvsfgfgphycpggmlarlese
    llvdavldrvpglklavapedvpfkkgalirgpealpvtwhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5de9B (B:)
    mteetisqavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddv
    rlvtndprfgreavmdrqvtrlaphfrpargavgfldppdhtrlrrsvaaaftargverv
    rersrgmldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlils
    sshgaevseraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllq
    iggeavtnnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialed
    veikgvriragdavyvsylaanrdpevfpdpdridferspnphvsfgfgphycpggmlar
    lesellvdavldrvpglklavapedvpfkkgalirgpealpvtwhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5de9B (B:)
    tisqavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddvrlvt
    ndprfgreavmdrqvtrlaphfrpargavgfldppdhtrlrrsvaaaftargvervrers
    rgmldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlilssshg
    aevseraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllqigge
    avtnnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialedveik
    gvriragdavyvsylaanrdpevfpdpdridferspnphvsfgfgphycpggmlarlese
    llvdavldrvpglklavapedvpfkkgalirgpealpvtwhh