PDB entry 5ddp

View 5ddp on RCSB PDB site
Description: L-glutamine riboswitch bound with L-glutamine
Class: RNA binding protein/RNA
Keywords: riboswitch, L-glutamine, bound-form, RNA, RNA BINDING PROTEIN-RNA complex
Deposited on 2015-08-25, released 2015-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA (61-mer)
    Species: Synechococcus elongatus [TaxId:32046]
  • Chain 'B':
    Compound: RNA (61-mer)
    Species: Synechococcus elongatus [TaxId:32046]
  • Chain 'C':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered mutation (29)
      • engineered mutation (34)
    Domains in SCOPe 2.08: d5ddpc_
  • Chain 'D':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered mutation (29)
      • engineered mutation (34)
    Domains in SCOPe 2.08: d5ddpd_
  • Heterogens: GLN, MG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ddpC (C:)
    avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ddpC (C:)
    petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
    satnalrsmqgfpfydkpmriqyaktdsdiiak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ddpD (D:)
    avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ddpD (D:)
    vpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkev
    ssatnalrsmqgfpfydkpmriqyaktdsdiiak