PDB entry 5ddd

View 5ddd on RCSB PDB site
Description: menin in complex with MI-836
Class: protein binding/inhibitor
Keywords: PROTEIN BINDING, PROTEIN BINDING-INHIBITOR complex
Deposited on 2015-08-24, released 2015-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Menin
    Species: Homo sapiens [TaxId:9606]
    Gene: MEN1, SCG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ddda1, d5ddda2
  • Heterogens: 59X, SO4, DMS, PG4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dddA (A:)
    ggsssmglkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrvgl
    tyfpvadlsiiaalyarftaqirgavdlslypreggvssrelvkkvsdviwnslsrsyfk
    drahiqslfsfitgtkldssgvafavvgacqalglrdvhlalsedhawvvfgpngeqtae
    vtwhgkgnedrrgqtvnagvaerswlylkgsymrcdrkmevafmvcainpsidlhtdsle
    llqlqqkllwllydlghlerypmalgnladleeleptpgrpdpltlyhkgiasaktyyrd
    ehiypymylagyhcrnrnvrealqawadtatviqdynycredeeiykeffevandvipnl
    lkeaaslleagsqgsalqdpecfahllrfydgickweegsptpvlhvgwatflvqslgrf
    egqvrqkvrivsvpapaaspppegpvltfqsekmkgmkellvatkinssaiklqltaqsq
    vqmkkqkvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dddA (A:)
    glkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrvgltyfpva
    dlsiiaalyarftaqirgavdlslypreggvssrelvkkvsdviwnslsrsyfkdrahiq
    slfsfitgtkldssgvafavvgacqalglrdvhlalsedhawvvfgpngeqtaevtwhgk
    gnedrrgqtvnagvaerswlylkgsymrcdrkmevafmvcainpsidlhtdslellqlqq
    kllwllydlghlerypmalgnladleeleptpgrpdpltlyhkgiasaktyyrdehiypy
    mylagyhcrnrnvrealqawadtatviqdynycredeeiykeffevandvipnllkeaas
    lleagsqgsalqdpecfahllrfydgickweegsptpvlhvgwatflvqslgrfegqvrq
    kvrivspvltfqsekmkgmkellvatkinssaiklqltaqsqvqmk