PDB entry 5dd4

View 5dd4 on RCSB PDB site
Description: Apo structure of transcriptional factor AraR from Bacteroides thetaiotaomicron VPI
Class: transcription regulator
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, AraR, DNA binding, TRANSCRIPTIONAL REGULATOR, BACTEROIDES THETAIOTAOMICRON, HELIX-TURN-HELIX MOTIF, NUDIX FOLD, TRANSCRIPTION REGULATOR
Deposited on 2015-08-24, released 2015-09-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulator AraR
    Species: Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) [TaxId:226186]
    Gene: BT_0354
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5dd4a1, d5dd4a2
  • Heterogens: EDO, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dd4A (A:)
    snamknyyssnptfylgidciifgfnegeisllllkrnfepamgewslmggfvqkdesvd
    daakrvlaeltglenvymeqvgafgaidrdpgervvsiayyalinineydrelvqkhnay
    wvninelpalifdhpemvdkaremmkqkasvepigfnllpklftlsqlqslyeaiygepm
    dkrnfrkrvaemdfiektdkidklgskrgaalykfngkayrkdpkfkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dd4A (A:)
    yssnptfylgidciifgfnegeisllllkrnfepamgewslmggfvqkdesvddaakrvl
    aeltglenvymeqvgafgaidrdpgervvsiayyalinineydrelvqkhnaywvninel
    palifdhpemvdkaremmkqkasvepigfnllpklftlsqlqslyeaiygepmdkrnfrk
    rvaemdfiektdkidklgskrgaalykfngkayrkdpkfkl