PDB entry 5dcm

View 5dcm on RCSB PDB site
Description: Structure of a lantibiotic response regulator: C-terminal domain of the nisin resistance regulator NsrR
Class: signaling protein
Keywords: Antimicrobial peptide, lantibiotic, nisin, resistance/regulation, two component system, signaling protein
Deposited on 2015-08-24, released 2016-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-06, with a file datestamp of 2016-07-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PhoB family transcriptional regulator
    Species: STREPTOCOCCUS AGALACTIAE [TaxId:1311]
    Gene: DK41_05180, EN72_05470
    Database cross-references and differences (RAF-indexed):
    • Uniprot X5JZS1 (Start-221)
      • expression tag (222-224)
    Domains in SCOPe 2.07: d5dcma1, d5dcma2
  • Chain 'B':
    Compound: PhoB family transcriptional regulator
    Species: STREPTOCOCCUS AGALACTIAE [TaxId:1311]
    Gene: DK41_05180, EN72_05470
    Database cross-references and differences (RAF-indexed):
    • Uniprot X5JZS1 (Start-221)
      • expression tag (222-224)
    Domains in SCOPe 2.07: d5dcmb1, d5dcmb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dcmA (A:)
    msqeqgkiyiveddmtivsllkdhlsasyhvssvsnfrdvkqeiiafqpdlilmditlpy
    fngfywtaelrkfltipiifisssndemdmvmalnmggddfiskpfslavldakltailr
    rsqqfiqqeltfggftltregllssqdkevilsptenkilsillmhpkqvvskesllekl
    wendsfidqntlnvnmtrlrkkivpigfdyihtvrgvgyllqdpnsssvdklaaalehhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dcmA (A:)
    eltfggftltregllssqdkevilsptenkilsillmhpkqvvskeslleklwendsfid
    qntlnvnmtrlrkkivpigfdyihtvrgvgyllqdpn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dcmB (B:)
    msqeqgkiyiveddmtivsllkdhlsasyhvssvsnfrdvkqeiiafqpdlilmditlpy
    fngfywtaelrkfltipiifisssndemdmvmalnmggddfiskpfslavldakltailr
    rsqqfiqqeltfggftltregllssqdkevilsptenkilsillmhpkqvvskesllekl
    wendsfidqntlnvnmtrlrkkivpigfdyihtvrgvgyllqndpsssvdklaaalehhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dcmB (B:)
    qeltfggftltregllssqdkevilsptenkilsillmhpkqvvskeslleklwendsfi
    dqntlnvnmtrlrkkivpigfdyihtvrgvgyllqndp