PDB entry 5dby

View 5dby on RCSB PDB site
Description: Crystal Structure of Equine Serum Albumin in Complex with Diclofenac and Naproxen Obtained in Displacement Experiment
Class: transport protein
Keywords: Helical, Three-domain protein, Serum Albumin, Transport protein, Drugs delivery, Diclofenac, Naproxen
Deposited on 2015-08-22, released 2015-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum albumin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dbya1, d5dbya2, d5dbya3
  • Heterogens: DIF, NPS, MLI, SIN, ACT, FMT, LMR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dbyA (A:)
    dthkseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesae
    ncdkslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepd
    aqcaafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddkagclipk
    ldalkerillssakerlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkv
    hkecchgdllecaddradlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsd
    lpalaadfaedkeickhykdakdvflgtflyeysrrhpdysvslllriaktyeatlekcc
    aeadppacyatvfdqftplveepkslvkkncdlfeevgeydfqnalivrytkkapqvstp
    tlveigrtlgkvgsrccklpeserlpcsenhlalalnrlcvlhektpvsekitkcctdsl
    aerrpcfsaleldegyvpkefkaetftfhadictlpedekqikkqsalaelvkhkpkatk
    eqlktvlgnfsafvakccgaedkeacfaeegpklvassqlala
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dbyA (A:)
    kseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesaencd
    kslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepdaqc
    aafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddkagclipklda
    lkerillssakerlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkvhke
    cchgdllecaddradlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsdlpa
    laadfaedkeickhykdakdvflgtflyeysrrhpdysvslllriaktyeatlekccaea
    dppacyatvfdqftplveepkslvkkncdlfeevgeydfqnalivrytkkapqvstptlv
    eigrtlgkvgsrccklpeserlpcsenhlalalnrlcvlhektpvsekitkcctdslaer
    rpcfsaleldegyvpkefkaetftfhadictlpedekqikkqsalaelvkhkpkatkeql
    ktvlgnfsafvakccgaedkeacfaeegpklvassqlala