PDB entry 5dbx

View 5dbx on RCSB PDB site
Description: Crystal structure of murine SPAK(T243D) in complex with AMPPNP
Class: transferase
Keywords: Kinase, TRANSFERASE
Deposited on 2015-08-22, released 2015-09-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: STE20/SPS1-related proline-alanine-rich protein kinase
    Species: Mus musculus [TaxId:10090]
    Gene: Stk39, Spak
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5dbxa_
  • Chain 'B':
    Compound: STE20/SPS1-related proline-alanine-rich protein kinase
    Species: Mus musculus [TaxId:10090]
    Gene: Stk39, Spak
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5dbxb_
  • Heterogens: ANP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dbxA (A:)
    aqavgwpicrdayelqevigsgatavvqaalckprqervaikrinlekcqtsmdellkei
    qamsqcshpnvvtyytsfvvkdelwlvmkllsggsmldiikyivnrgehkngvleeaiia
    tilkevlegldylhrngqihrdlkagnillgedgsvqiadfgvsaflatggdvtrnkvrk
    dfvgtpcwmapevmeqvrgydfkadmwsfgitaielatgaapyhkyppmkvlmltlqndp
    ptletgvedkemmkkygksfrkllslclqkdpskrptaaellkckffqkaknreyliekl
    ltrtpdiaqrakkvrrvpgssghlhkte
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dbxA (A:)
    avgwpicrdayelqevigsgatavvqaalckprqervaikrinlekcqtsmdellkeiqa
    msqcshpnvvtyytsfvvkdelwlvmkllsggsmldiikyivnrgehkngvleeaiiati
    lkevlegldylhrngqihrdlkagnillgedgsvqiadfgvsaflafvgtpcwmapevme
    qvrgydfkadmwsfgitaielatgaapyhkyppmkvlmltlqndpptletgvedkemmkk
    ygksfrkllslclqkdpskrptaaellkckffqkaknreylieklltr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dbxB (B:)
    aqavgwpicrdayelqevigsgatavvqaalckprqervaikrinlekcqtsmdellkei
    qamsqcshpnvvtyytsfvvkdelwlvmkllsggsmldiikyivnrgehkngvleeaiia
    tilkevlegldylhrngqihrdlkagnillgedgsvqiadfgvsaflatggdvtrnkvrk
    dfvgtpcwmapevmeqvrgydfkadmwsfgitaielatgaapyhkyppmkvlmltlqndp
    ptletgvedkemmkkygksfrkllslclqkdpskrptaaellkckffqkaknreyliekl
    ltrtpdiaqrakkvrrvpgssghlhkte
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dbxB (B:)
    avgwpicrdayelqevigsgatavvqaalckprqervaikrinlekmdellkeiqamsqc
    shpnvvtyytsfvvkdelwlvmkllsggsmldiikyivnrgehkngvleeaiiatilkev
    legldylhrngqihrdlkagnillgedgsvqiadfgvsaflatggfvgtpcwmapevmeq
    vrgydfkadmwsfgitaielatgaapyhkyppmkvlmltlqndpptletgvedkemmkky
    gksfrkllslclqkdpskrptaaellkckffqkaknreyliekllt