PDB entry 5db2

View 5db2 on RCSB PDB site
Description: Menin in complex with MI-389
Class: protein binding/inhibitor
Keywords: PROTEIN BINDING, PROTEIN BINDING-INHIBITOR complex
Deposited on 2015-08-20, released 2016-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Menin
    Species: Homo sapiens [TaxId:9606]
    Gene: MEN1, SCG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5db2a1, d5db2a2
  • Heterogens: 58R, DMS, PG4, SO4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5db2A (A:)
    ggsssmglkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrvgl
    tyfpvadlsiiaalyarftaqirgavdlslypreggvssrelvkkvsdviwnslsrsyfk
    drahiqslfsfitgtkldssgvafavvgacqalglrdvhlalsedhawvvfgpngeqtae
    vtwhgkgnedrrgqtvnagvaerswlylkgsymrcdrkmevafmvcainpsidlhtdsle
    llqlqqkllwllydlghlerypmalgnladleeleptpgrpdpltlyhkgiasaktyyrd
    ehiypymylagyhcrnrnvrealqawadtatviqdynycredeeiykeffevandvipnl
    lkeaaslleagsqgsalqdpecfahllrfydgickweegsptpvlhvgwatflvqslgrf
    egqvrqkvrivsvpapaaspppegpvltfqsekmkgmkellvatkinssaiklqltaqsq
    vqmkkqkvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5db2A (A:)
    glkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrvgltyfpva
    dlsiiaalyarftaqirgavdlslypreggvssrelvkkvsdviwnslsrsyfkdrahiq
    slfsfitgtkldssgvafavvgacqalglrdvhlalsedhawvvfgpngeqtaevtwhgk
    gnedrrgqtvnagvaerswlylkgsymrcdrkmevafmvcainpsidlhtdslellqlqq
    kllwllydlghlerypmalgnladleeleptpgrpdpltlyhkgiasaktyyrdehiypy
    mylagyhcrnrnvrealqawadtatviqdynycredeeiykeffevandvipnllkeaas
    lleagsqgsalqdpecfahllrfydgickweegsptpvlhvgwatflvqslgrfegqvrq
    kvrivsgpvltfqsekmkgmkellvatkinssaiklqltaqsqvqmkk