PDB entry 5dau

View 5dau on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS V39E/V104E at cryogenic temperature
Class: hydrolase
Keywords: nuclease, hyperstable, pdTp, ionizable group, HYDROLASE
Deposited on 2015-08-20, released 2015-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (38)
      • engineered mutation (43-44)
      • engineered mutation (97)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (121)
      • engineered mutation (132)
    Domains in SCOPe 2.07: d5daua_
  • Heterogens: CA, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dauA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrllledtpefnekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealerqglakvayvykgnntheqllr
    kaeaqakkeklnnwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dauA (A:)
    lhkepatlikaidgdtvklmykgqpmtfrllledtpefnekygpeasaftkkmvenakki
    evefdkgqrtdkygrglayiyadgkmvnealerqglakvayvykgnntheqllrkaeaqa
    kkeklnnws