PDB entry 5das

View 5das on RCSB PDB site
Description: Structure of Mycobacterium tuberculosis NadD in complex with NADP, P21212, form 2
Class: transferase
Keywords: Rossman fold, TRANSFERASE
Deposited on 2015-08-20, released 2016-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nicotinate-nucleotide adenylyltransferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: nadD, Rv2421c, MTCY428.26
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WJJ5 (9-200)
      • expression tag (0-3)
      • see remark 999 (4-8)
      • engineered mutation (196)
      • engineered mutation (200)
    Domains in SCOPe 2.07: d5dasa1, d5dasa2
  • Chain 'B':
    Compound: nicotinate-nucleotide adenylyltransferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: nadD, Rv2421c, MTCY428.26
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WJJ5 (9-200)
      • expression tag (0-3)
      • see remark 999 (4-8)
      • engineered mutation (196)
      • engineered mutation (200)
    Domains in SCOPe 2.07: d5dasb1, d5dasb2
  • Chain 'C':
    Compound: nicotinate-nucleotide adenylyltransferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: nadD, Rv2421c, MTCY428.26
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WJJ5 (9-200)
      • expression tag (0-3)
      • see remark 999 (4-8)
      • engineered mutation (196)
      • engineered mutation (200)
    Domains in SCOPe 2.07: d5dasc1, d5dasc2
  • Chain 'D':
    Compound: nicotinate-nucleotide adenylyltransferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: nadD, Rv2421c, MTCY428.26
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WJJ5 (9-200)
      • expression tag (0-3)
      • see remark 999 (4-8)
      • engineered mutation (196)
      • engineered mutation (200)
    Domains in SCOPe 2.07: d5dasd1, d5dasd2
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dasA (A:)
    gamgrrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpwqkgrqvsaaehryl
    mtviatasnprfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimswqg
    weelfelarfvgvsrpgyelrnehitsllgqlakdaltlveipalaisstdcrqraeqsr
    plwylmpdgvvqyvskrrlyt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dasA (A:)
    gamgrrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpwrqvsaaehrylmtv
    iatasnprfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimswqgwee
    lfelarfvgvsrpgyelrnehitsllgqlakdaltlveipalaisstdcrqraeqsrplw
    ylmpdgvvqyvskrrlyt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dasB (B:)
    gamgrrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpwqkgrqvsaaehryl
    mtviatasnprfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimswqg
    weelfelarfvgvsrpgyelrnehitsllgqlakdaltlveipalaisstdcrqraeqsr
    plwylmpdgvvqyvskrrlyt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dasB (B:)
    gamgrrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpvsaaehrylmtviat
    asnprfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimseelfelarf
    vgvsrpgaltlveipalaisstdcrqraeqsrplwylmpdgvvqyvskrrlyt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5dasC (C:)
    gamgrrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpwqkgrqvsaaehryl
    mtviatasnprfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimswqg
    weelfelarfvgvsrpgyelrnehitsllgqlakdaltlveipalaisstdcrqraeqsr
    plwylmpdgvvqyvskrrlyt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dasC (C:)
    gamgrrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpwqkgrqvsaaehryl
    mtviatasnprfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimswee
    lfelarfvgvsrpgaltlveipalaisstdcrqraeqsrplwylmpdgvvqyvskrrlyt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5dasD (D:)
    gamgrrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpwqkgrqvsaaehryl
    mtviatasnprfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimswqg
    weelfelarfvgvsrpgyelrnehitsllgqlakdaltlveipalaisstdcrqraeqsr
    plwylmpdgvvqyvskrrlyt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dasD (D:)
    gamgrrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpvsaaehrylmtviat
    asnprfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimseelfelarf
    vgvsrpaltlveipalaisstdcrqraeqsrplwylmpdgvvqyvskrrlyt