PDB entry 5da5

View 5da5 on RCSB PDB site
Description: Crystal structure of Rhodospirillum rubrum Rru_A0973
Class: oxidoreductase
Keywords: ferritin, iron, ferroxidase, oxidoreductase
Deposited on 2015-08-19, released 2016-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • expression tag (96)
    Domains in SCOPe 2.07: d5da5a1, d5da5a2
  • Chain 'B':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • expression tag (96)
    Domains in SCOPe 2.07: d5da5b1, d5da5b2
  • Chain 'C':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5da5c_
  • Chain 'D':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • expression tag (96)
    Domains in SCOPe 2.07: d5da5d1, d5da5d2
  • Chain 'E':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5da5e_
  • Chain 'F':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • expression tag (96)
    Domains in SCOPe 2.07: d5da5f1, d5da5f2
  • Chain 'G':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • expression tag (96)
    Domains in SCOPe 2.07: d5da5g1, d5da5g2
  • Chain 'H':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • expression tag (96)
    Domains in SCOPe 2.07: d5da5h1, d5da5h2
  • Chain 'I':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • expression tag (96)
    Domains in SCOPe 2.07: d5da5i1, d5da5i2
  • Chain 'J':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • expression tag (96)
    Domains in SCOPe 2.07: d5da5j1, d5da5j2
  • Chain 'K':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • expression tag (96)
    Domains in SCOPe 2.07: d5da5k1, d5da5k2
  • Chain 'L':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • expression tag (96)
    Domains in SCOPe 2.07: d5da5l1, d5da5l2
  • Chain 'M':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5da5m_
  • Chain 'N':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • expression tag (96)
    Domains in SCOPe 2.07: d5da5n1, d5da5n2
  • Chain 'O':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5da5o_
  • Chain 'P':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • expression tag (96)
    Domains in SCOPe 2.07: d5da5p1, d5da5p2
  • Chain 'Q':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5da5q_
  • Chain 'R':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5da5r_
  • Chain 'S':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5da5s_
  • Chain 'T':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • expression tag (96)
    Domains in SCOPe 2.07: d5da5t1, d5da5t2
  • Chain 'U':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • expression tag (96)
    Domains in SCOPe 2.07: d5da5u1, d5da5u2
  • Chain 'V':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5da5v_
  • Chain 'W':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5da5w_
  • Chain 'X':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5da5x_
  • Chain 'Y':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5da5y_
  • Chain 'Z':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5da5z_
  • Chain 'a':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • expression tag (96)
  • Chain 'b':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: Rru_A0973
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: Rru_A0973
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RVS1 (Start-95)
      • expression tag (96)
  • Heterogens: FE, GOA, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5da5A (A:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5A (A:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5da5B (B:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5B (B:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5da5C (C:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5C (C:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpita
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5da5D (D:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5D (D:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5da5E (E:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5E (E:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpita
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5da5F (F:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5F (F:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5da5G (G:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5G (G:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5da5H (H:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5H (H:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5da5I (I:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5I (I:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5da5J (J:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5J (J:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5da5K (K:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5K (K:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5da5L (L:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5L (L:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5da5M (M:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5M (M:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpita
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5da5N (N:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5N (N:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5da5O (O:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5O (O:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpita
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5da5P (P:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5P (P:)
    theplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekehaa
    mtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >5da5Q (Q:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5Q (Q:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpita
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >5da5R (R:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5R (R:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpita
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >5da5S (S:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5S (S:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpit
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >5da5T (T:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5T (T:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >5da5U (U:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5U (U:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpitaa
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >5da5V (V:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5V (V:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpita
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >5da5W (W:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5W (W:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpita
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >5da5X (X:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5X (X:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpit
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >5da5Y (Y:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5Y (Y:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpit
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >5da5Z (Z:)
    maqssnstheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrd
    eekehaamtlewlrrndakwaehlrtylftegpitaansssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da5Z (Z:)
    stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
    amtlewlrrndakwaehlrtylftegpit
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.