PDB entry 5d9z
View 5d9z on RCSB PDB site
Description: Structure of Colocasia Esculenta Agglutinin with mannose bound
Class: sugar binding protein
Keywords: lectin, protein-carbohydrate interactions, dietary protein, beta prism II fold, 18-aug, sugar binding protein
Deposited on
2015-08-19, released
2016-02-24
The last revision prior to the SCOPe 2.08 freeze date was dated
2020-07-29, with a file datestamp of
2020-07-02.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.38
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Tuber agglutinin
Species: Colocasia esculenta [TaxId:4460]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d5d9za_ - Chain 'B':
Compound: Tuber agglutinin
Species: Colocasia esculenta [TaxId:4460]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d5d9zb_ - Heterogens: BMA, PO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>5d9zA (A:)
lgtnyllsgqtldreghlkngdfdlvmqddcnlvlyngnwqsntankgrdckltltdyge
lvikngdgstvwrsraqsvkgnyaavvhpdgrlvvfgpsvfkidpwvpg
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>5d9zB (B:)
nipftnnllfsgqvlygdgrltakshqlvmqgdcnlvlyggkygwqsnthgngehcflrl
nhkgeliikdddfktiwsssssskhgdyvlilrddgfaviygpaiwetspqa