PDB entry 5d9n

View 5d9n on RCSB PDB site
Description: Crystal structure of PbGH5A, a glycoside hydrolase family 5 member from Prevotella bryantii B14, in complex with the xyloglucan heptasaccharide XXXG
Class: hydrolase
Keywords: endo-beta-glucanase/endo-xyloglucanase, GLYCOSYL HYDROLASE FAMILY 5, MIXED ALPHA-BETA, TIM BARREL, HYDROLASE
Deposited on 2015-08-18, released 2015-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-1,4-endoglucanase
    Species: Prevotella bryantii [TaxId:77095]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d9na_
  • Chain 'B':
    Compound: B-1,4-endoglucanase
    Species: Prevotella bryantii [TaxId:77095]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d9nb_
  • Heterogens: CA, BGC, XYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5d9nA (A:)
    minqnatymeesaqsavdnfglgfnlgntldangcgtgkpvatyetfwgqpettqdmmtf
    lmqngfnavripvtwyehmdaegnvdeawmmrvkaiveyamnaglyaivnvhhdtaagsg
    awikadtdvyaatkekfkklwtqianaladydqhllfegynemldgnnswdepqkasgye
    alnnyaqdfvdavratggnnatrnlivntyaaakgenvlnnfmlptdavnnhlivqvhsy
    dpwnffntkttwdsechntlteifsalskkfttipyiigeygthgesdisvsksspaeki
    klaadqaadmvklakdhhsatfywmsifdgsdriqpqwslptvveamqeaynn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d9nA (A:)
    natymeesaqsavdnfglgfnlgntldangcgtgkpvatyetfwgqpettqdmmtflmqn
    gfnavripvtwyehmdaegnvdeawmmrvkaiveyamnaglyaivnvhhdtaagsgawik
    adtdvyaatkekfkklwtqianaladydqhllfegynemldgnnswdepqkasgyealnn
    yaqdfvdavratggnnatrnlivntyaaakgenvlnnfmlptdavnnhlivqvhsydpwn
    ffntkttwdsechntlteifsalskkfttipyiigeygthgesdisvsksspaekiklaa
    dqaadmvklakdhhsatfywmsifdgsdriqpqwslptvveamqeaynn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5d9nB (B:)
    minqnatymeesaqsavdnfglgfnlgntldangcgtgkpvatyetfwgqpettqdmmtf
    lmqngfnavripvtwyehmdaegnvdeawmmrvkaiveyamnaglyaivnvhhdtaagsg
    awikadtdvyaatkekfkklwtqianaladydqhllfegynemldgnnswdepqkasgye
    alnnyaqdfvdavratggnnatrnlivntyaaakgenvlnnfmlptdavnnhlivqvhsy
    dpwnffntkttwdsechntlteifsalskkfttipyiigeygthgesdisvsksspaeki
    klaadqaadmvklakdhhsatfywmsifdgsdriqpqwslptvveamqeaynn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d9nB (B:)
    atymeesaqsavdnfglgfnlgntldangcgtgkpvatyetfwgqpettqdmmtflmqng
    fnavripvtwyehmdaegnvdeawmmrvkaiveyamnaglyaivnvhhdtaagsgawika
    dtdvyaatkekfkklwtqianaladydqhllfegynemldgnnswdepqkasgyealnny
    aqdfvdavratggnnatrnlivntyaaakgenvlnnfmlptdavnnhlivqvhsydpwnf
    fntkttwdsechntlteifsalskkfttipyiigeygthgesdisvsksspaekiklaad
    qaadmvklakdhhsatfywmsifdgsdriqpqwslptvveamqeaynn