PDB entry 5d9f

View 5d9f on RCSB PDB site
Description: Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
Class: Transferase/Transferase Inhibitor
Keywords: TrmD, Dimerization, tRNA Methyltransferases, S-adenosyl methionine, SAM-binding, Transferase-Transferase Inhibitor complex
Deposited on 2015-08-18, released 2016-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-31, with a file datestamp of 2016-08-24.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA (guanine-N(1)-)-methyltransferase
    Species: Haemophilus influenzae [TaxId:71421]
    Gene: trmD, HI_0202
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43912 (8-End)
      • expression tag (5-7)
    Domains in SCOPe 2.07: d5d9fa1, d5d9fa2
  • Heterogens: 58G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5d9fA (A:)
    glvprgshmwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddr
    pygggpgmlmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvc
    gryegiderliqteideewsigdyvltggelpamtlidavarfipgvlgkqasaeedsfa
    dglldcphytrpevlegltvppvlmsghheeirkwrlkqslqrtwlrrpelleglaltde
    qrkllkeaqaehns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d9fA (A:)
    gshmwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpyggg
    pgmlmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryeg
    iderliqteideewsigdyvltggelpamtlidavarfipgvlgdglldcphytrpevle
    gltvppvlmsghheeirkwrlkqslqrtwlrrpelleglaltdeqrkllkeaqaehn