PDB entry 5d8v

View 5d8v on RCSB PDB site
Description: Ultra-high resolution structure of high-potential iron-sulfur protein
Class: metal binding protein
Keywords: iron-sulfur protein, METAL BINDING PROTEIN
Deposited on 2015-08-18, released 2016-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 0.48 Å
R-factor: N/A
AEROSPACI score: 1.9 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high-potential iron-sulfur protein
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d8va_
  • Heterogens: SF4, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5d8vA (A:)
    aapanavtaddptaialkynqdatkservaaarpglppeeqhcancqfmqanvgegdwkg
    cqlfpgklinvngwcaswtlkag