PDB entry 5d8o

View 5d8o on RCSB PDB site
Description: 1.90A resolution structure of BfrB (wild-type, C2221 form) from Pseudomonas aeruginosa
Class: oxidoreductase
Keywords: ELECTRON TRANSPORT, IRON STORAGE, iron binding, iron mobilization, OXIDOREDUCTASE
Deposited on 2015-08-17, released 2015-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d8oa_
  • Chain 'B':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d8ob_
  • Chain 'C':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d8oc_
  • Chain 'D':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d8od_
  • Chain 'E':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d8oe_
  • Chain 'F':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d8of_
  • Chain 'G':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d8og_
  • Chain 'H':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d8oh_
  • Chain 'I':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d8oi_
  • Chain 'J':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d8oj_
  • Chain 'K':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d8ok_
  • Chain 'L':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d8ol_
  • Heterogens: K, PG4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5d8oA (A:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8oA (A:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5d8oB (B:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8oB (B:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5d8oC (C:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8oC (C:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5d8oD (D:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8oD (D:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5d8oE (E:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8oE (E:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5d8oF (F:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8oF (F:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5d8oG (G:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8oG (G:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5d8oH (H:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8oH (H:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5d8oI (I:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8oI (I:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5d8oJ (J:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8oJ (J:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5d8oK (K:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8oK (K:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5d8oL (L:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8oL (L:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe