PDB entry 5d8g

View 5d8g on RCSB PDB site
Description: A structural view on the dissociation of E. coli Tryptophanase
Class: lyase
Keywords: tryptophanase, PLP-dependent enzyme, cold dissociation, hydrophobic interactions, open conformation, closed conformation, lyase
Deposited on 2015-08-17, released 2015-12-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophanase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: tnaA, ind, b3708, JW3686
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A853 (0-466)
      • conflict (54)
    Domains in SCOPe 2.05: d5d8ga_
  • Heterogens: CL, MG, EPE, NA, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5d8gA (A:)
    khlpepfrirviepvkrttrayreeaiiksgmnpflldsedvfidlltdsgtgamtqsmq
    aammrgdeaysgsrsyyalaesvknifgyqytipthqgrgaeqiyipvlikkreqekgld
    rskmvafsnyffdttqghsqingctvrnvyikeafdtgvrydfkgnfdleglergieevg
    pnnvpyivatitsnsaggqpvslanlkamysiakkydipvvmdsarfaenayfikqreae
    ykdwtieqitretykyadmlamsakkdamvpmggllcmkddsffdvytecrtlcvvqegf
    ptyggleggamerlavglydgmnldwlayriaqvqylvdgleeigvvcqqagghaafvda
    gkllphipadqfpaqalacelykvagiraveigsfllgrdpktgkqlpcpaellrltipr
    atytqthmdfiieafkhvkenaanikgltftyepkvlrhftaklkev
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8gA (A:)
    khlpepfrirviepvkrttrayreeaiiksgmnpflldsedvfidlltdsgtgamtqsmq
    aammrgdeaysgsrsyyalaesvknifgyqytipthrgaeqiyipvlikkreqekgldrs
    kmvafsnyffdttqghsqingctvrnvyikeafdtgvrydfkgnfdleglergieevgpn
    nvpyivatitsnsaggqpvslanlkamysiakkydipvvmdsarfaenayfikqreaeyk
    dwtieqitretykyadmlamsakkdamvpmggllcmkddsffdvytecrtlcvvqegfpt
    yggleggamerlavglydgmnldwlayriaqvqylvdgleeigvvcqqagghaafvdagk
    llphipadqfpaqalacelykvagiraveigsfllgrdpktgkqlpcpaellrltiprat
    ytqthmdfiieafkhvkenaanikgltftyepkvlrhftaklkev