PDB entry 5d7x

View 5d7x on RCSB PDB site
Description: Crystal structure of the human BRPF1 bromodomain in complex with XZ08
Class: DNA binding protein
Keywords: Bromodomain and PHD finger-containing protein 1(BRPF1), monocytic leukemia zinc-finger (MOZ), Inhibitor, DNA binding protein
Deposited on 2015-08-14, released 2016-05-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-05-25, with a file datestamp of 2016-05-20.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peregrin
    Species: Homo sapiens [TaxId:9606]
    Gene: BRPF1, BR140
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55201 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.06: d5d7xa1, d5d7xa2
  • Heterogens: NO3, XZ8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5d7xA (A:)
    smemqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnlea
    yrylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d7xA (A:)
    smemqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnlea
    yrylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekm