PDB entry 5d7o

View 5d7o on RCSB PDB site
Description: Crystal structure of Sirt2-ADPR at an improved resolution
Class: hydrolase
Keywords: Hydrolase, Human Sirt2, Deacylase
Deposited on 2015-08-14, released 2015-12-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nad-dependent protein deacetylase sirtuin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT2, SIR2L, SIR2L2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5d7oa_
  • Chain 'B':
    Compound: nad-dependent protein deacetylase sirtuin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT2, SIR2L, SIR2L2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5d7ob_
  • Heterogens: ZN, AR6, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5d7oA (A:)
    ghmslgsqkerlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydn
    lekyhlpypeaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcyt
    qnidtleriagleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqs
    lvkpdivffgeslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllin
    kekagqsdpflgmimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvr
    rehasidaqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d7oA (A:)
    rlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhlpype
    aifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtleria
    gleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivffg
    eslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqsdpf
    lgmimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasidaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5d7oB (B:)
    ghmslgsqkerlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydn
    lekyhlpypeaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcyt
    qnidtleriagleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqs
    lvkpdivffgeslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllin
    kekagqsdpflgmimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvr
    rehasidaqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d7oB (B:)
    kerlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhlpy
    peaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtler
    iagleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivf
    fgeslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqsd
    pflgmimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasida
    q