PDB entry 5d78

View 5d78 on RCSB PDB site
Description: Structure of RRM3 Domain of Mip6 at 1.25 A Resolution
Class: RNA binding protein
Keywords: RNA Binding Protein, RNA Binding Domain
Deposited on 2015-08-13, released 2016-08-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-08-17, with a file datestamp of 2016-08-12.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RNA-binding protein MIP6
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Gene: MIP6, YHR015W
  Database cross-references and differences (RAF-indexed):
  • Uniprot P38760 (6-80)
    • expression tag (0-5)
  Domains in SCOPe 2.08: d5d78a1, d5d78a2
• Heterogens: BME, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5d78A (A:)
  gplgsmktilvknlpsdttqeevldyfstigpiksvfisekqantphkafvtykneeesk
  kaqkclnktifknhtiwvgpg