PDB entry 5d75

View 5d75 on RCSB PDB site
Description: Crystal structure of Human FKBD25 in complex with FK506
Class: isomerase/inhibitor
Keywords: FK506, FKBP25, FKBP3, Immunophilin, Inhibitor, ISOMERASE-INHIBITOR complex
Deposited on 2015-08-13, released 2016-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-06, with a file datestamp of 2016-04-01.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase FKBP3
    Species: Homo sapiens [TaxId:9606]
    Gene: FKBP3, FKBP25
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00688 (0-115)
      • expression tag (116-119)
    Domains in SCOPe 2.07: d5d75a1, d5d75a2
  • Heterogens: FK5, 6JZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5d75A (A:)
    pkytksvlkkgdktnfpkkgdvvhcwytgtlqdgtvfdtniqtsakkkknakplsfkvgv
    gkvirgwdealltmskgekarleiepewaygkkgqpdakippnakltfevelvdidlehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d75A (A:)
    pkytksvlkkgdktnfpkkgdvvhcwytgtlqdgtvfdtniqtsakkkknakplsfkvgv
    gkvirgwdealltmskgekarleiepewaygkkgqpdakippnakltfevelvdidlehh