PDB entry 5d6x

View 5d6x on RCSB PDB site
Description: Crystal structure of double tudor domain of human lysine demethylase KDM4A
Class: oxidoreductase
Keywords: double tudor domain, reader domain, Structural Genomics, PSI-2, Protein Structure Initiative, Enzyme Discovery for Natural Product Biosynthesis, NatPro, OXIDOREDUCTASE
Deposited on 2015-08-13, released 2015-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysine-specific demethylase 4a
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM4A, JHDM3A, JMJD2, JMJD2A, KIAA0677
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5d6xa1, d5d6xa2
  • Chain 'B':
    Compound: lysine-specific demethylase 4a
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM4A, JHDM3A, JMJD2, JMJD2A, KIAA0677
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5d6xb1, d5d6xb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5d6xA (A:)
    gshmalqsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqd
    clqfgppaegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytldeel
    p
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d6xA (A:)
    qsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdclqfgp
    paegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytldeelp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5d6xB (B:)
    gshmalqsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqd
    clqfgppaegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytldeel
    p
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d6xB (B:)
    qsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdclqfgp
    paegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytldeelp