PDB entry 5d6r

View 5d6r on RCSB PDB site
Description: Acetolactate Synthase from Klebsiella pneumoniae in Complex with Mechanism-Based Inhibitor
Class: transferase
Keywords: Inhibition Intermediate Synthase, TRANSFERASE
Deposited on 2015-08-12, released 2016-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Acetolactate synthase, catabolic
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: budB, ilvK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27696
      • engineered mutation (426)
    Domains in SCOPe 2.07: d5d6rb1, d5d6rb2, d5d6rb3
  • Chain 'M':
    Compound: Acetolactate synthase, catabolic
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: budB, ilvK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27696 (20-End)
      • expression tag (15-19)
      • engineered mutation (426)
    Domains in SCOPe 2.07: d5d6rm1, d5d6rm2, d5d6rm3, d5d6rm4
  • Heterogens: MG, PO4, EN0, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5d6rB (B:)
    mgsshhhhhhssglvprgshmdkqypvrqwahgadlvvsqleaqgvrqvfgipgakidkv
    fdslldssiriipvrheanaafmaaavgritgkagvalvtsgpgcsnlitgmatansegd
    pvvalggavkradkakqvhqsmdtvamfspvtkyaievtapdalaevvsnafraaeqgrp
    gsafvslpqdvvdgpvsgkvlpasgapqmgaapddaidqvakliaqaknpifllglmasq
    penskalrrlletshipvtstyqaagavnqdnfsrfagrvglfnnqagdrllqladlvic
    igyspveyepamwnsgnatlvhidvlpayeernytpdvelvgdiagtlnklaqnidhrlv
    lspqaaeilrdrqhqrelldrrgaqlnqfalhplrivramqdivnsdvtltvdmgsfhiw
    iarylysfrarqvmisngqqtmgvalpwaigawlvnperkvvsvsgdggflqssmeleta
    vrlkanvlhliwvdngynmvaiqeekkyqrlsgvefgpmdfkayaesfgakgfavesaea
    leptlraamdvdgpavvaipvdyrdnpllmgqlhlsqil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d6rB (B:)
    vrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafmaaa
    vgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqvhqsmdtva
    mfspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpaspq
    mgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaagav
    nqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlpa
    yeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldrrgaqlnq
    falhplrivramqdivnsdvtltvdmgsfhiwiarylysfrarqvmisngqqtmgvalpw
    aigawlvnperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmvaiqeekky
    qrlsgvefgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaipvdyrdnpl
    lmgqlhls
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5d6rM (M:)
    mgsshhhhhhssglvprgshmdkqypvrqwahgadlvvsqleaqgvrqvfgipgakidkv
    fdslldssiriipvrheanaafmaaavgritgkagvalvtsgpgcsnlitgmatansegd
    pvvalggavkradkakqvhqsmdtvamfspvtkyaievtapdalaevvsnafraaeqgrp
    gsafvslpqdvvdgpvsgkvlpasgapqmgaapddaidqvakliaqaknpifllglmasq
    penskalrrlletshipvtstyqaagavnqdnfsrfagrvglfnnqagdrllqladlvic
    igyspveyepamwnsgnatlvhidvlpayeernytpdvelvgdiagtlnklaqnidhrlv
    lspqaaeilrdrqhqrelldrrgaqlnqfalhplrivramqdivnsdvtltvdmgsfhiw
    iarylysfrarqvmisngqqtmgvalpwaigawlvnperkvvsvsgdggflqssmeleta
    vrlkanvlhliwvdngynmvaiqeekkyqrlsgvefgpmdfkayaesfgakgfavesaea
    leptlraamdvdgpavvaipvdyrdnpllmgqlhlsqil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d6rM (M:)
    prgshmdkqypvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvr
    heanaafmaaavgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradka
    kqvhqsmdtvamfspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgp
    vsgkvlpasgapqmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletsh
    ipvtstyqaagavnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwns
    gnatlvhidvlpayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhq
    relqlnqfalhplrivramqdivnsdvtltvdmgsfhiwiarylysfrarqvmisngqqt
    mgvalpwaigawlvnperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmva
    iqeekkyqrlsgvefgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaipv
    dyrdnpllmgqlh