PDB entry 5d6m

View 5d6m on RCSB PDB site
Description: Mn(II)-loaded MnCcP.1
Class: oxidoreductase
Keywords: Peroxidase fold, Mn(II)-CcP, Mn oxidation, Glutamate, OXIDOREDUCTASE
Deposited on 2015-08-12, released 2016-03-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-23, with a file datestamp of 2016-03-18.
No data on structure quality are available

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c peroxidase, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CCP1, CCP, CPO, YKR066C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (0-290)
      • engineered mutation (33)
      • engineered mutation (41)
      • engineered mutation (49)
      • engineered mutation (148)
      • engineered mutation (177)
    Domains in SCOPe 2.06: d5d6ma_
  • Heterogens: HEM, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5d6mA (A:)
    lvhvasvekgrsyedfqkvynaialklreddeyenyigygpelvrlawhisgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgktelk
    nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
    ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl