PDB entry 5d6d

View 5d6d on RCSB PDB site
Description: Crystal structure of GASDALIE IgG1 Fc in complex with FcgRIIIa
Class: immune system
Keywords: ADCC, Immune system, IgG
Deposited on 2015-08-12, released 2016-02-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-02, with a file datestamp of 2016-02-26.
Experiment type: XRAY
Resolution: 3.13 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (38)
      • engineered mutation (41)
      • engineered mutation (132)
      • engineered mutation (134)
    Domains in SCOPe 2.06: d5d6da1, d5d6da2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (38)
      • engineered mutation (41)
      • engineered mutation (132)
      • engineered mutation (134)
    Domains in SCOPe 2.06: d5d6db1, d5d6db2
  • Chain 'C':
    Compound: Low affinity immunoglobulin gamma Fc region receptor III-A
    Species: Homo sapiens [TaxId:9606]
    Gene: FCGR3A, CD16A, FCG3, FCGR3, IGFR3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08637
      • engineered mutation (91)
      • engineered mutation (186)
    Domains in SCOPe 2.06: d5d6dc1, d5d6dc2
  • Heterogens: NAG, BMA, MAN, GAL, FUL, FUC

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5d6dA (A:)
    mefglswlflvailkgvqcevqlletstcppcpapellagpdvflfppkpkdtlmisrtp
    evtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynstyrvvsvltvlhqdwlngk
    eykckvsnkalplpeektiskakgqprepqvytlppsrdeltknqvsltclvkgfypsdi
    avewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhyt
    qkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d6dA (A:)
    agpdvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalplpeektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5d6dB (B:)
    mefglswlflvailkgvqcevqlletstcppcpapellagpdvflfppkpkdtlmisrtp
    evtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynstyrvvsvltvlhqdwlngk
    eykckvsnkalplpeektiskakgqprepqvytlppsrdeltknqvsltclvkgfypsdi
    avewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhyt
    qkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d6dB (B:)
    agpdvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalplpeektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5d6dC (C:)
    mwqlllptallllvsagmrtedlpkavvflepqwyrvlekdsvtlkcqgayspedqstqw
    fhneslissqassyfidaatvddsgeyrcqtqlstlsdpvqlevhigwlllqaprwvfke
    edpihlrchswkntalhkvtylqngkgrkyfhhnsdfyipkatlkdsgsyfcrglfgskn
    vssetvqititqglavstissffppsrggggsgggghvlndifeaqkiewhetghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d6dC (C:)
    avvflepqwyrvlekdsvtlkcqgatqwfhneslissqassyfidaatvddsgeyrcqtq
    lsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhkvtylqngkgrkyfhhns
    dfyipkatlkdsgsyfcrglfgsknvssetvqititq