PDB entry 5d65

View 5d65 on RCSB PDB site
Description: x-ray structure of macrophage inflammatory protein-1 alpha (ccl3) with heparin complex
Class: cytokine
Keywords: CC chemokine, CCL3, OLIGOMER, SIGNALING PROTEIN, HEPARIN, GAG, COMPLEX, CYTOKINE
Deposited on 2015-08-11, released 2016-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-18, with a file datestamp of 2016-05-13.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d65a_
  • Chain 'B':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d65b_
  • Chain 'C':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d65c_
  • Chain 'D':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d65d_
  • Chain 'E':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d65e_
  • Heterogens: BGC, CL, SGN, IDS, GLC

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5d65A (A:)
    aslaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kyvsdlelsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d65A (A:)
    slaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqk
    yvsdlels
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5d65B (B:)
    aslaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kyvsdlelsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d65B (B:)
    laadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqky
    vsdlels
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5d65C (C:)
    aslaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kyvsdlelsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d65C (C:)
    laadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqky
    vsdlels
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5d65D (D:)
    aslaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kyvsdlelsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d65D (D:)
    laadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqky
    vsdlels
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5d65E (E:)
    aslaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kyvsdlelsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d65E (E:)
    aslaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kyvsdlels