PDB entry 5d5g

View 5d5g on RCSB PDB site
Description: Structure of colocasia esculenta agglutinin
Class: sugar binding protein
Keywords: carbohydrate binding, lectin, agglutinin, beta prism II, sugar binding protein
Deposited on 2015-08-10, released 2015-09-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-09-02, with a file datestamp of 2015-08-28.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tuber agglutinin
    Species: Colocasia esculenta [TaxId:4460]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5d5ga_
  • Chain 'B':
    Compound: Tuber agglutinin
    Species: Colocasia esculenta [TaxId:4460]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5d5gb_
  • Chain 'C':
    Compound: Tuber agglutinin
    Species: Colocasia esculenta [TaxId:4460]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5d5gc_
  • Chain 'D':
    Compound: Tuber agglutinin
    Species: Colocasia esculenta [TaxId:4460]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5d5gd_
  • Heterogens: MG, EPE, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5d5gA (A:)
    lgtnyllsgqtldreghlkngdfdlvmqddcnlvlyngnwqsntankgrdckltltdyge
    lvikngdgstvwrsraqsvkgnyaavvhpdgrlvvfgpsvfkidpwvpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5d5gB (B:)
    nipftnnllfsgqvlygdgrltakshqlvmqgdcnlvlyggkygwqsnthgngehcflrl
    nhkgeliikdddfktiwsssssskhgdyvlilrddgfaviygpaiwetspq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d5gB (B:)
    nipftnnllfsgqvlygdgrltakshqlvmqgdcnlvlyggkygwqsnthgngehcflrl
    nhkgeliikdddfktiwsssssskhgdyvlilrddgfaviygpaiwetsp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5d5gC (C:)
    lgtnyllsgqtldreghlkngdfdlvmqddcnlvlyngnwqsntankgrdckltltdyge
    lvikngdgstvwrsraqsvkgnyaavvhpdgrlvvfgpsvfkidpwvpg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5d5gD (D:)
    nipftnnllfsgqvlygdgrltakshqlvmqgdcnlvlyggkygwqsnthgngehcflrl
    nhkgeliikdddfktiwsssssskhgdyvlilrddgfaviygpaiwetspq