PDB entry 5d41

View 5d41 on RCSB PDB site
Description: EGFR kinase domain in complex with mutant selective allosteric inhibitor
Class: transferase/transferase inhibitor
Keywords: Allosteric inhibitor, EGFR, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2015-08-07, released 2016-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
      • engineered mutation (256)
    Domains in SCOPe 2.07: d5d41a_
  • Chain 'B':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
      • engineered mutation (256)
    Domains in SCOPe 2.07: d5d41b_
  • Heterogens: MG, ANP, 57N, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5d41A (A:)
    gstsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d41A (A:)
    apnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkank
    eildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnw
    cvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglvpikwmalesilhriythq
    sdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimrkcwmid
    adsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvvdad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5d41B (B:)
    gstsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d41B (B:)
    qallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankeil
    deayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvq
    iakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllkvpikwmalesilhriyt
    hqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimrkcwm
    idadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvvd
    ad