PDB entry 5d3k

View 5d3k on RCSB PDB site
Description: Crystal structure of the thioesterase domain of deoxyerythronolide B synthase
Class: hydrolase
Keywords: Thioesterase domaine Alpha / beta hydrolase fold deoxyerythronolide B synthase, HYDROLASE
Deposited on 2015-08-06, released 2015-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Erythronolide synthase, modules 5 and 6
    Species: Saccharopolyspora erythraea [TaxId:1836]
    Gene: eryA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5d3ka_
  • Heterogens: 1PE, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5d3kA (A:)
ssalrdgyrqagvsgrvrsyldllaglsdfrehfdgsdgfsldlvdmadgpgevtvicca
gtaaisgpheftrlagalrgiapvravpqpgyeegeplpssmaavaavqadavirtqgdk
pfvvaghsagalmayalatelldrghpprgvvlidvyppghqdamnawleeltatlfdre
tvrmddtrltalgaydrltgqwrpretglptllvsagepmgpwpddswkptwpfehdtva
vpgdhftmvqehadaiarhidawlgggns