PDB entry 5d1v

View 5d1v on RCSB PDB site
Description: Crystal Structure and Thermal Stability of Hemoglobin from Thermophilic Phototrophic Bacterium Chloroflexus aurantiacus
Class: oxygen transport
Keywords: truncated Hemoglobin, temperature stability, OXYGEN TRANSPORT
Deposited on 2015-08-04, released 2016-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-10, with a file datestamp of 2016-08-05.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: globin
    Species: Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) [TaxId:324602]
    Gene: Caur_0123
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d1va_
  • Chain 'B':
    Compound: globin
    Species: Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) [TaxId:324602]
    Gene: Caur_0123
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d1vb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5d1vA (A:)
    mseptiyeqiggeatfrrivdifyarveadprlrhlfpadlepgkehqrlflmqyfggpr
    tyserrghprlrmrhapfpigprerdawlehmlaalneagvpeparsvmenyfrhaaqam
    mnrlged
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d1vA (A:)
    eptiyeqiggeatfrrivdifyarveadprlrhlfpadlepgkehqrlflmqyfggprty
    serrghprlrmrhapfpigprerdawlehmlaalneagvpeparsvmenyfrhaaqammn
    r
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5d1vB (B:)
    mseptiyeqiggeatfrrivdifyarveadprlrhlfpadlepgkehqrlflmqyfggpr
    tyserrghprlrmrhapfpigprerdawlehmlaalneagvpeparsvmenyfrhaaqam
    mnrlged
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d1vB (B:)
    eptiyeqiggeatfrrivdifyarveadprlrhlfpadlepgkehqrlflmqyfggprty
    serrghprlrmrhapfpigprerdawlehmlaalneagvpeparsvmenyfrhaaqammn
    r