PDB entry 5d1t

View 5d1t on RCSB PDB site
Description: Anthrax toxin lethal factor with hydroxamic acid inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: Anthrax toxin, lethal factor, metalloproteinase, metalloprotease, structural dynamics, ligand-induced conformational change, hydrolase-hydrolase inhibitor complex
Deposited on 2015-08-04, released 2015-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lethal Factor
    Species: Bacillus anthracis [TaxId:1392]
    Gene: lef, pXO1-107, BXA0172, GBAA_pXO1_0172
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d1ta1, d5d1ta2
  • Heterogens: ZN, 56R, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5d1tA (A:)
    snalsryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkr
    iqidssdflsteekeflkklqidirdslseeekellnriqvdssnplsekekeflkklkl
    diqpydinqrlqdtgglidspsinldvrkqykrdiqnidallhqsigstlynkiylyenm
    ninnltatlgadlvdstdntkinrgifnefkknfkysissnymivdinerpaldnerlkw
    riqlspdtragylengklilqrnigleikdvqiikqsekeyiridakvvpkskidtkiqe
    aqlninqewnkalglpkytklitfnvhnryasnivesaylilnewknniqsdlikkvtny
    lvdgngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhgpskgvelrnds
    egfihefghavddyagylldknqsdlvtnskkfidifkeegsnltsygrtneaeffaeaf
    rlmhstdhaerlkvqknapktfqfindqikfiinslvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d1tA (A:)
    ryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriqids
    sdflsteekeflkklqidilsekekeflkklkldiqpydinqrlqdtgglidspsinldv
    rkqykrdiqnidallhqsigstlynkiylyenmninnltatlgadlvdstdntkinrgif
    nefkknfkysissnymivdinerpaldnerlkwriqlspdtragylengklilqrnigle
    ikdvqiikqsekeyiridakvvpkskidtkiqeaqlninqewnkalglpkytklitfnvh
    nryasnivesaylilnewknniqsdlikkvtnylvdgngrfvftditlpniaeqythqde
    iyeqvhskglyvpesrsillhgpskgvelrndsegfihefghavddyagylldknqsdlv
    tnskkfidifkeegsnltsygrtneaeffaeafrlmhstdhaerlkvqknapktfqfind
    qikfiins