PDB entry 5d1k

View 5d1k on RCSB PDB site
Description: Crystal Structure of UbcH5B in Complex with the RING-U5BR Fragment of AO7
Class: Ligase
Keywords: ubiquitin conjugating enzyme (E2), ubiquitin ligase (E3), RING finger, ubiquitination, ubiquitin, Ligase
Deposited on 2013-10-08, released 2015-10-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-10-28, with a file datestamp of 2015-10-23.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating enzyme e2 d2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2D2, PUBC1, UBC4, UBC5B, UBCH4, UBCH5B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5d1ka_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase RNF25
    Species: Homo sapiens [TaxId:9606]
    Gene: RNF25
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, PEG, OXL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5d1kA (A:)
malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrekynriarewtqkyam

    Sequence, based on observed residues (ATOM records): (download) 
    >5d1kA (A:)
alkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrekynriarewtqkyam

  • Chain 'B':
    No sequence available.