PDB entry 5czm

View 5czm on RCSB PDB site
Description: Crystal structure of a mutated catalytic domain of Human MMP12 in complex with RXP470
Class: hydrolase
Keywords: Matrix, Metallo Elastase, MMP12, human, RXP470, Macrophage, hydrolase
Deposited on 2015-07-31, released 2016-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-158)
      • initiating methionine (0)
      • engineered mutation (66)
      • engineered mutation (136)
    Domains in SCOPe 2.07: d5czma_
  • Heterogens: ZN, CA, R47, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5czmA (A:)
mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
glghssdpkavmfptyayvdintfrlsaddirgiqslyg