PDB entry 5cz1

View 5cz1 on RCSB PDB site
Description: Crystal structure of the catalytic core domain of MMTV integrase
Class: hydrolase
Keywords: integrase, POL, retrovirus, catalytic core domain, hydrolase
Deposited on 2015-07-31, released 2016-02-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-02, with a file datestamp of 2016-02-26.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Mouse mammary tumor virus [TaxId:11757]
    Gene: gag-pro-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot O56220 (Start-162)
      • expression tag (163-165)
    Domains in SCOPe 2.06: d5cz1a1, d5cz1a2
  • Chain 'B':
    Compound: integrase
    Species: Mouse mammary tumor virus [TaxId:11757]
    Gene: gag-pro-pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5cz1b_
  • Chain 'C':
    Compound: integrase
    Species: Mouse mammary tumor virus [TaxId:11757]
    Gene: gag-pro-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot O56220 (Start-162)
      • expression tag (163-165)
    Domains in SCOPe 2.06: d5cz1c1, d5cz1c2
  • Chain 'D':
    Compound: integrase
    Species: Mouse mammary tumor virus [TaxId:11757]
    Gene: gag-pro-pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5cz1d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cz1A (A:)
    mvnprglkprvlwqmdvthvsefgklkyvhvtvdtyshftfatartgeatkdvlqhlaqs
    faymgipqkiktdnapayvsrsiqeflarwkishvtgipynpqgqaiverthqnikaqln
    klqkagkyytphhllahalfvlnhvnmdnqghtaaerhwgpislevlfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cz1A (A:)
    rglkprvlwqmdvthvsefgklkyvhvtvdtyshftfatartgeatkdvlqhlaqsfaym
    gipqkiktdnapayvsrsiqeflarwkishvtgipynpqgqaiverthqnikaqlnklqk
    agkyytphhllahalfvlnhvnmdnqghtaaerhwgpislev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cz1B (B:)
    mvnprglkprvlwqmdvthvsefgklkyvhvtvdtyshftfatartgeatkdvlqhlaqs
    faymgipqkiktdnapayvsrsiqeflarwkishvtgipynpqgqaiverthqnikaqln
    klqkagkyytphhllahalfvlnhvnmdnqghtaaerhwgpislevlfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cz1B (B:)
    glkprvlwqmdvthvsefgklkyvhvtvdtyshftfatartgeatkdvlqhlaqsfaymg
    ipqkiktayvsrsiqeflarwkishvtgipynpqgqaiverthqnikaqlnklqkagkyy
    tphhllahalfvlnhvnmdnqghtaaerhw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5cz1C (C:)
    mvnprglkprvlwqmdvthvsefgklkyvhvtvdtyshftfatartgeatkdvlqhlaqs
    faymgipqkiktdnapayvsrsiqeflarwkishvtgipynpqgqaiverthqnikaqln
    klqkagkyytphhllahalfvlnhvnmdnqghtaaerhwgpislevlfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cz1C (C:)
    glkprvlwqmdvthvsefgklkyvhvtvdtyshftfatartgeatkdvlqhlaqsfaymg
    ipqkiktdnapayvsrsiqeflarwkishvtgipynpqgqaiverthqnikaqlnklqka
    gkyytphhllahalfvlnhvnmdnqghtaaerhwgpislev
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5cz1D (D:)
    mvnprglkprvlwqmdvthvsefgklkyvhvtvdtyshftfatartgeatkdvlqhlaqs
    faymgipqkiktdnapayvsrsiqeflarwkishvtgipynpqgqaiverthqnikaqln
    klqkagkyytphhllahalfvlnhvnmdnqghtaaerhwgpislevlfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cz1D (D:)
    kprvlwqmdvthvsefgklkyvhvtvdtyshftfatartgeatkdvlqhlaqsfaymgip
    qkiktdnapayvsrsiqeflarwkishvtaiverthqnikaqlnklqkagkyytphhlla
    halfvlnhvnmdnqghtaaerhw