PDB entry 5cyt

View 5cyt on RCSB PDB site
Description: refinement of myoglobin and cytochrome c
Class: electron transport (heme protein)
Keywords: electron transport (heme protein)
Deposited on 1988-01-14, released 1989-07-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.159
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'R':
    Compound: cytochrome c
    Species: Thunnus alalunga [TaxId:8235]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81459 (0-102)
      • conflict (60-61)
    Domains in SCOPe 2.05: d5cytr_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5cytR (R:)
    gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
    ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats