PDB entry 5cyn

View 5cyn on RCSB PDB site
Description: JC Virus large T-antigen origin binding domain F258L mutant
Class: viral protein, dna binding protein
Keywords: DNA binding domain, origin binding domain, viral protein, dna binding protein
Deposited on 2015-07-30, released 2015-12-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-01-20, with a file datestamp of 2016-01-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: large t antigen
    Species: JC polyomavirus [TaxId:10632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03072
      • engineered mutation (126)
    Domains in SCOPe 2.08: d5cyna_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cynA (A:)
    kvedpkdfpvdlhaflsqavfsnrtvasfavyttkekaqilykklmekysvtfisrhgfg
    ghnilffltphrhrvsainnycqklctfsflickgvnkeylfysalcrqpyavveesiqg
    glkehdlnpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cynA (A:)
    vedpkdfpvdlhaflsqavfsnrtvasfavyttkekaqilykklmekysvtfisrhgfgg
    hnilffltphrhrvsainnycqklctfsflickgvnkeylfysalcrqpyavveesiqgg
    lkehdln