PDB entry 5cy7

View 5cy7 on RCSB PDB site
Description: Structure of Xoo1075, a peptide deformylase from Xanthomonas oryze pv oryze, in complex with fragment 275
Class: hydrolase/hydrolase inhibitor
Keywords: a peptide deformylase, Xanthomonas, fragment, metallopeptidase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2015-07-30, released 2016-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-08-03, with a file datestamp of 2016-07-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptide deformylase
  Species: Xanthomonas oryzae pv. oryzae KACC10331 [TaxId:291331]
  Gene: def, XOO1075
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5H3Z2 (0-170)
  Domains in SCOPe 2.08: d5cy7a_
• Heterogens: CD, ACT, 56U, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5cy7A (A:)
  mirdiirmgdkrllrvapqvtnlgsaelhalvsdmfetmgaahgvglaapqiavdlqlmv
  fgfeaserypeapavpltalanaqieplsdemengwegclsipglravipryryiryrgf
  apdgspiereaegfharvvqheydhlvgrlypsrienfdtfgfddvlsydl