PDB entry 5cxz

View 5cxz on RCSB PDB site
Description: SYK catalytic domain complexed with naphthyridine inhibitor
Class: Transferase/transferase inhibitor
Keywords: Transferase/transferase inhibitor, Transferase-transferase inhibitor complex
Deposited on 2015-07-29, released 2015-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43405 (Start-282)
      • engineered mutation (114)
      • expression tag (283-284)
    Domains in SCOPe 2.07: d5cxza1, d5cxza2
  • Heterogens: GOL, CL, 55U, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cxzA (A:)
    maleeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpa
    lkdellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvtdknii
    elvhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthg
    kwpvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermg
    cpagcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cxzA (A:)
    vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilknalkdellaeanvmqql
    dnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvtdkniielvhqvsmgmkylee
    snfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthkwpvkwyapecinyyk
    fssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlc
    wtydvenrpgfaavelrlrnyyydvvnhh