PDB entry 5cxh

View 5cxh on RCSB PDB site
Description: SYK catalytic domain complexed with a potent orally bioavailable thiazole inhibitor
Class: Transferase/Transferase inhibitor
Keywords: Transferase-Transferase inhibitor complex
Deposited on 2015-07-29, released 2015-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43405 (Start-282)
      • engineered mutation (114)
      • expression tag (283-286)
    Domains in SCOPe 2.07: d5cxha1, d5cxha2
  • Heterogens: 55M, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cxhA (A:)
    maleeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpa
    lkdellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvtdknii
    elvhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthg
    kwpvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermg
    cpagcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cxhA (A:)
    vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaean
    vmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvtdkniielvhqvsmgm
    kyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyape
    cinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremy
    dlmnlcwtydvenrpgfaavelrlrnyyydvvnhhhh