PDB entry 5cx1

View 5cx1 on RCSB PDB site
Description: Nitrogenase molybdenum-iron protein beta-K400E mutant
Class: oxidoreductase
Keywords: Nitrogen fixation, Oxidoreductase
Deposited on 2015-07-28, released 2015-09-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5cx1a_
  • Chain 'B':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07329 (Start-522)
      • engineered mutation (399)
    Domains in SCOPe 2.08: d5cx1b_
  • Chain 'C':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5cx1c_
  • Chain 'D':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07329 (Start-522)
      • engineered mutation (399)
    Domains in SCOPe 2.08: d5cx1d_
  • Chain 'E':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5cx1e_
  • Chain 'F':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07329 (Start-522)
      • engineered mutation (399)
    Domains in SCOPe 2.08: d5cx1f_
  • Chain 'G':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5cx1g_
  • Chain 'H':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07329 (Start-522)
      • engineered mutation (399)
    Domains in SCOPe 2.08: d5cx1h_
  • Chain 'I':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5cx1i_
  • Chain 'J':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07329 (Start-522)
      • engineered mutation (399)
    Domains in SCOPe 2.08: d5cx1j_
  • Chain 'K':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5cx1k_
  • Chain 'L':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07329 (Start-522)
      • engineered mutation (399)
    Domains in SCOPe 2.08: d5cx1l_
  • Chain 'M':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5cx1m_
  • Chain 'N':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07329 (Start-522)
      • engineered mutation (399)
    Domains in SCOPe 2.08: d5cx1n_
  • Chain 'O':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5cx1o_
  • Chain 'P':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07329 (Start-522)
      • engineered mutation (399)
    Domains in SCOPe 2.08: d5cx1p_
  • Heterogens: HCA, ICS, CLF, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cx1A (A:)
    mtgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtir
    gcayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqe
    kdivfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivp
    vrcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssri
    lleemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynff
    gptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrp
    rhvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdl
    igsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cx1A (A:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cx1B (B:)
    msqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqre
    altvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmte
    daavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefp
    vpfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvi
    krmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlek
    tkkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdsht
    wlhgkrfalwgdpdfvmglvkfllelgcepvhilchngnerwkkavdailaaspygknat
    vyigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlh
    rsttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cx1B (B:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnerwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5cx1C (C:)
    mtgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtir
    gcayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqe
    kdivfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivp
    vrcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssri
    lleemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynff
    gptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrp
    rhvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdl
    igsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cx1C (C:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5cx1D (D:)
    msqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqre
    altvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmte
    daavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefp
    vpfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvi
    krmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlek
    tkkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdsht
    wlhgkrfalwgdpdfvmglvkfllelgcepvhilchngnerwkkavdailaaspygknat
    vyigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlh
    rsttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cx1D (D:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnerwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5cx1E (E:)
    mtgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtir
    gcayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqe
    kdivfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivp
    vrcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssri
    lleemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynff
    gptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrp
    rhvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdl
    igsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cx1E (E:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5cx1F (F:)
    msqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqre
    altvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmte
    daavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefp
    vpfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvi
    krmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlek
    tkkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdsht
    wlhgkrfalwgdpdfvmglvkfllelgcepvhilchngnerwkkavdailaaspygknat
    vyigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlh
    rsttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cx1F (F:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnerwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5cx1G (G:)
    mtgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtir
    gcayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqe
    kdivfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivp
    vrcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssri
    lleemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynff
    gptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrp
    rhvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdl
    igsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cx1G (G:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5cx1H (H:)
    msqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqre
    altvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmte
    daavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefp
    vpfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvi
    krmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlek
    tkkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdsht
    wlhgkrfalwgdpdfvmglvkfllelgcepvhilchngnerwkkavdailaaspygknat
    vyigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlh
    rsttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cx1H (H:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnerwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5cx1I (I:)
    mtgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtir
    gcayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqe
    kdivfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivp
    vrcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssri
    lleemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynff
    gptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrp
    rhvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdl
    igsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cx1I (I:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5cx1J (J:)
    msqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqre
    altvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmte
    daavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefp
    vpfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvi
    krmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlek
    tkkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdsht
    wlhgkrfalwgdpdfvmglvkfllelgcepvhilchngnerwkkavdailaaspygknat
    vyigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlh
    rsttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cx1J (J:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnerwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5cx1K (K:)
    mtgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtir
    gcayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqe
    kdivfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivp
    vrcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssri
    lleemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynff
    gptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrp
    rhvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdl
    igsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cx1K (K:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5cx1L (L:)
    msqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqre
    altvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmte
    daavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefp
    vpfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvi
    krmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlek
    tkkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdsht
    wlhgkrfalwgdpdfvmglvkfllelgcepvhilchngnerwkkavdailaaspygknat
    vyigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlh
    rsttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cx1L (L:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnerwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5cx1M (M:)
    mtgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtir
    gcayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqe
    kdivfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivp
    vrcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssri
    lleemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynff
    gptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrp
    rhvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdl
    igsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cx1M (M:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5cx1N (N:)
    msqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqre
    altvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmte
    daavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefp
    vpfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvi
    krmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlek
    tkkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdsht
    wlhgkrfalwgdpdfvmglvkfllelgcepvhilchngnerwkkavdailaaspygknat
    vyigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlh
    rsttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cx1N (N:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnerwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5cx1O (O:)
    mtgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtir
    gcayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqe
    kdivfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivp
    vrcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssri
    lleemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynff
    gptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrp
    rhvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdl
    igsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cx1O (O:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5cx1P (P:)
    msqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqre
    altvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmte
    daavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefp
    vpfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvi
    krmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlek
    tkkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdsht
    wlhgkrfalwgdpdfvmglvkfllelgcepvhilchngnerwkkavdailaaspygknat
    vyigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlh
    rsttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cx1P (P:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnerwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr