PDB entry 5cvt

View 5cvt on RCSB PDB site
Description: Structure of a single tryptophan mutant of Acetobacter aceti PurE containing 5-fluorotryptophan, pH 5.4
Class: isomerase
Keywords: acidophile, PurE, purine biosynthesis, isomerase
Deposited on 2015-07-27, released 2016-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-10, with a file datestamp of 2016-08-05.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N5-carboxyaminoimidazole ribonucleotide mutase
    Species: Acetobacter aceti 1023 [TaxId:1457393]
    Gene: purE, AZ09_02690
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A063X4U8
      • engineered mutation (34)
      • engineered mutation (165)
    Domains in SCOPe 2.07: d5cvta_
  • Chain 'B':
    Compound: N5-carboxyaminoimidazole ribonucleotide mutase
    Species: Acetobacter aceti 1023 [TaxId:1457393]
    Gene: purE, AZ09_02690
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A063X4U8
      • engineered mutation (34)
      • engineered mutation (165)
    Domains in SCOPe 2.07: d5cvtb_
  • Heterogens: ACT, CIT, K, PGF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cvtA (A:)
    mmsetaplpsassaledkaasapvvgiimgsqsdfetmrhadallteleiphetlivsah
    rtpdrladyartaaerglnviiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsll
    sivqmpggvpvgtlaigasgaknaallaasilalynpalaarletfralqtasvpnspit
    edk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cvtA (A:)
    sapvvgiimgsqsdfetmrhadallteleiphetlivsahrtpdrladyartaaerglnv
    iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
    aknaallaasilalynpalaarletfralqtasvpnspit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cvtB (B:)
    mmsetaplpsassaledkaasapvvgiimgsqsdfetmrhadallteleiphetlivsah
    rtpdrladyartaaerglnviiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsll
    sivqmpggvpvgtlaigasgaknaallaasilalynpalaarletfralqtasvpnspit
    edk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cvtB (B:)
    sapvvgiimgsqsdfetmrhadallteleiphetlivsahrtpdrladyartaaerglnv
    iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
    aknaallaasilalynpalaarletfralqtasvpnspited