PDB entry 5cv8

View 5cv8 on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS V23D/T62H at cryogenic temperature
Class: hydrolase
Keywords: nuclease, hyperstable, pdTp, ionizable group, HYDROLASE
Deposited on 2015-07-25, released 2015-08-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (22)
      • engineered mutation (43-44)
      • engineered mutation (55)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (121)
    Domains in SCOPe 2.08: d5cv8a_
  • Heterogens: THP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5cv8A (A:)
atstkklhkepatlikaidgdtdklmykgqpmtfrlllvdtpefnekygpeasafhkkmv
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
kaeaqakkeklniwsednasgq

    Sequence, based on observed residues (ATOM records): (download) 
    >5cv8A (A:)
lhkepatlikaidgdtdklmykgqpmtfrlllvdtpefnekygpeasafhkkmvenakki
evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
kkeklniws