PDB entry 5ctj

View 5ctj on RCSB PDB site
Description: Structure of a single tryptophan mutant of Acetobacter aceti PurE containing 5-fluorotryptophan
Class: isomerase
Keywords: acidophile, PurE, purine biosynthesis, isomerase
Deposited on 2015-07-24, released 2016-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-03, with a file datestamp of 2016-07-29.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N5-carboxyaminoimidazole ribonucleotide mutase
    Species: Acetobacter aceti 1023 [TaxId:1457393]
    Gene: purE, AZ09_02690
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A063X4U8
      • engineered mutation (34)
      • engineered mutation (165)
    Domains in SCOPe 2.07: d5ctja_
  • Chain 'B':
    Compound: N5-carboxyaminoimidazole ribonucleotide mutase
    Species: Acetobacter aceti 1023 [TaxId:1457393]
    Gene: purE, AZ09_02690
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A063X4U8
      • engineered mutation (34)
      • engineered mutation (165)
    Domains in SCOPe 2.07: d5ctjb_
  • Heterogens: SO4, EDO, CL, PG0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ctjA (A:)
    mmsetaplpsassaledkaasapvvgiimgsqsdfetmrhadallteleiphetlivsah
    rtpdrladyartaaerglnviiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsll
    sivqmpggvpvgtlaigasgaknaallaasilalynpalaarletfralqtasvpnspit
    edk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ctjA (A:)
    apvvgiimgsqsdfetmrhadallteleiphetlivsahrtpdrladyartaaerglnvi
    iagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasga
    knaallaasilalynpalaarletfralqtasvpnspi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ctjB (B:)
    mmsetaplpsassaledkaasapvvgiimgsqsdfetmrhadallteleiphetlivsah
    rtpdrladyartaaerglnviiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsll
    sivqmpggvpvgtlaigasgaknaallaasilalynpalaarletfralqtasvpnspit
    edk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ctjB (B:)
    sapvvgiimgsqsdfetmrhadallteleiphetlivsahrtpdrladyartaaerglnv
    iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
    aknaallaasilalynpalaarletfralqtasvpnspite