PDB entry 5cte

View 5cte on RCSB PDB site
Description: Humanized yeast ACC carboxyltransferase domain bound to 2,2-dimethylpropyl (1S)-1-methyl-8-[(7-methyl-1H-indazol-5-yl)carbonyl]-2,8-diazaspiro[4.5]decane-2-carboxylate
Class: transferase/transferase inhibitor
Keywords: ACC, inhibitors, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2015-07-23, released 2015-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: acetyl-coa carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ACC1, ABP2, FAS3, MTR7, YNR016C, N3175
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00955 (Start-760)
      • engineered mutation (287)
      • engineered mutation (289)
      • engineered mutation (292)
      • engineered mutation (446-447)
      • engineered mutation (452)
      • engineered mutation (555)
      • engineered mutation (557)
      • engineered mutation (559)
      • expression tag (761)
  • Chain 'C':
    Compound: acetyl-coa carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ACC1, ABP2, FAS3, MTR7, YNR016C, N3175
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00955 (Start-760)
      • engineered mutation (287)
      • engineered mutation (289)
      • engineered mutation (292)
      • engineered mutation (446-447)
      • engineered mutation (452)
      • engineered mutation (555)
      • engineered mutation (557)
      • engineered mutation (559)
    Domains in SCOPe 2.07: d5ctec1, d5ctec2
  • Heterogens: 57L, SO4, HOH

PDB Chain Sequences:

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5cteC (C:)
    masgsmhlrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkl
    tddffisneliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfk
    igsfgpqedeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkg
    fqylyltsegmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsglia
    gatsrayhdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgasalnkvlgrevyt
    snlqlggtqimynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvd
    ftptndetydvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvi
    gvetrtvenlipadpanpnsaetliqqagqvwfpnsafktaqaindfnngeqlpmmilan
    wrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqm
    emyadvnaragvlepegtveikfrreklldtmnrlddkyrelrsqlsnkslapevhqqis
    kqladrerellpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlne
    eylikrlshqvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglkle
    sfaqdlakkirsdhdnaidglsevikmlstddkekllktlklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cteC (C:)
    wlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneliedengelt
    everepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedeffnkvteya
    rkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegmetlkkfdk
    ensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhdiftitlvtcr
    svgigaylvrlgqraiqvegqpiiltgasalnkvlgrevytsnlqlggtqimynngvshl
    tavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndetydvrwmiegre
    tesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtvenlipadpanpn
    saetliqqagqvwfpnsafktaqaindfnngeqlpmmilanwrgfsggqrdmfnevlkyg
    sfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnaragvlepegtv
    eikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskqladrerellpiygqisl
    qfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlshqvasrlekia
    rirswypasvdheddrqvatwieenyktlddklkgnaidglsevikmlstddkekllktl
    k