PDB entry 5ct8

View 5ct8 on RCSB PDB site
Description: G158E/K44E/R57E/Y49E Bacillus subtilis lipase A with 0% [BMIM][Cl]
Class: hydrolase
Keywords: mutant, lipase, IL, HYDROLASE
Deposited on 2015-07-23, released 2015-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-03, with a file datestamp of 2016-01-29.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Quadruple mutant lipase A
    Species: Bacillus subtilis [TaxId:1423]
    Gene: lipA, QX56_01625
    Database cross-references and differences (RAF-indexed):
    • Uniprot I6V559 (Start-179)
      • engineered mutation (42)
      • engineered mutation (47)
      • engineered mutation (55)
      • engineered mutation (156)
    Domains in SCOPe 2.07: d5ct8a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ct8A (A:)
    ehnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdetgtnenngpvlsefvqk
    vldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnq
    kilytsiyssadmivmnylsrldgarnvqihgvghiellyssqvnslikeglngggqntn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ct8A (A:)
    hnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdetgtnenngpvlsefvqkv
    ldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnqk
    ilytsiyssadmivmnylsrldgarnvqihgvghiellyssqvnslikeglngggqntn