PDB entry 5csr

View 5csr on RCSB PDB site
Description: Crystal structure of triosephosphate isomerase from Thermoplasma acidophilium
Class: isomerase
Keywords: Triosephoshate isomerase, Thermoplasma acidophilium, TIM, TPI, ISOMERASE
Deposited on 2015-07-23, released 2016-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) [TaxId:273075]
    Gene: tpiA, Ta0313
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5csra_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) [TaxId:273075]
    Gene: tpiA, Ta0313
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5csrb_
  • Chain 'C':
    Compound: triosephosphate isomerase
    Species: Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) [TaxId:273075]
    Gene: tpiA, Ta0313
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HLB6 (2-217)
      • expression tag (218-221)
    Domains in SCOPe 2.07: d5csrc1, d5csrc2
  • Chain 'D':
    Compound: triosephosphate isomerase
    Species: Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) [TaxId:273075]
    Gene: tpiA, Ta0313
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HLB6 (2-217)
      • expression tag (218-221)
    Domains in SCOPe 2.07: d5csrd1, d5csrd2
  • Heterogens: GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5csrA (A:)
    mdmytaivnlktyreatganftrfmekfepvqgkfelifspslldlekaakcgkfrffaq
    hvdaepygaytghvpmdmmidlgitgsilnhserrlprdtiintlkkaskldftivlcve
    naeeakyfreyepdfiayeprdliggdvsvstakpeiiedivkiyegtgtsvlvgagikt
    gedvrrsiglgargilvasgvvksadptkslnslielklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5csrA (A:)
    mytaivnlktyreatganftrfmekfepvqgkfelifspslldlekaakcgkfrffaqhv
    daepygaytghvpmdmmidlgitgsilnhserrlprdtiintlkkaskldftivlcvena
    eeakyfreyepdfiayeprdliggdvsvstakpeiiedivkiyegtgtsvlvgagiktge
    dvrrsiglgargilvasgvvksadptkslnsliel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5csrB (B:)
    mdmytaivnlktyreatganftrfmekfepvqgkfelifspslldlekaakcgkfrffaq
    hvdaepygaytghvpmdmmidlgitgsilnhserrlprdtiintlkkaskldftivlcve
    naeeakyfreyepdfiayeprdliggdvsvstakpeiiedivkiyegtgtsvlvgagikt
    gedvrrsiglgargilvasgvvksadptkslnslielklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5csrB (B:)
    mytaivnlktyreatganftrfmekfepvqgkfelifspslldlekaakcgkfrffaqhv
    daepygaytghvpmdmmidlgitgsilnhserrlprdtiintlkkaskldftivlcvena
    eeakyfreyepdfiayeprdliggdvsvstakpeiiedivkiyegtgtsvlvgagiktge
    dvrrsiglgargilvasgvvksadptkslnsliel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5csrC (C:)
    mdmytaivnlktyreatganftrfmekfepvqgkfelifspslldlekaakcgkfrffaq
    hvdaepygaytghvpmdmmidlgitgsilnhserrlprdtiintlkkaskldftivlcve
    naeeakyfreyepdfiayeprdliggdvsvstakpeiiedivkiyegtgtsvlvgagikt
    gedvrrsiglgargilvasgvvksadptkslnslielklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5csrC (C:)
    mytaivnlktyreatganftrfmekfepvqgkfelifspslldlekaakcgkfrffaqhv
    daepygaytghvpmdmmidlgitgsilnhserrlprdtiintlkkaskldftivlcvena
    eeakyfreyepdfiayeprdliggdvsvstakpeiiedivkiyegtgtsvlvgagiktge
    dvrrsiglgargilvasgvvksadptkslnslielklehh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5csrD (D:)
    mdmytaivnlktyreatganftrfmekfepvqgkfelifspslldlekaakcgkfrffaq
    hvdaepygaytghvpmdmmidlgitgsilnhserrlprdtiintlkkaskldftivlcve
    naeeakyfreyepdfiayeprdliggdvsvstakpeiiedivkiyegtgtsvlvgagikt
    gedvrrsiglgargilvasgvvksadptkslnslielklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5csrD (D:)
    mytaivnlktyreatganftrfmekfepvqgkfelifspslldlekaakcgkfrffaqhv
    daepygaytghvpmdmmidlgitgsilnhserrlprdtiintlkkaskldftivlcvena
    eeakyfreyepdfiayeprdliggdvsvstakpeiiedivkiyegtgtsvlvgagiktge
    dvrrsiglgargilvasgvvksadptkslnslielklehh