PDB entry 5csn

View 5csn on RCSB PDB site
Description: S100B-RSK1 crystal structure C
Class: transferase
Keywords: S100, Kinase, Signaling, Inhibitor, transferase
Deposited on 2015-07-23, released 2015-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-B
    Species: Homo sapiens [TaxId:9606]
    Gene: S100B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04271 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5csna1, d5csna2
  • Chain 'B':
    Compound: Protein S100-B
    Species: Homo sapiens [TaxId:9606]
    Gene: S100B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04271 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5csnb1, d5csnb2
  • Chain 'C':
    Compound: Ribosomal protein S6 kinase alpha-1
    Species: Homo sapiens [TaxId:9606]
    Gene: RPS6KA1, MAPKAPK1A, RSK1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5csnA (A:)
    gshmselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkv
    metldndgdgecdfqefmafvamvttacheffehe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5csnA (A:)
    gshmselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkv
    metldndgdgecdfqefmafvamvttacheffeh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5csnB (B:)
    gshmselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkv
    metldndgdgecdfqefmafvamvttacheffehe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5csnB (B:)
    shmselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvm
    etldndgdgecdfqefmafvamvttacheff
    

  • Chain 'C':
    No sequence available.