PDB entry 5csm

View 5csm on RCSB PDB site
Description: yeast chorismate mutase, t226s mutant, complex with trp
Class: complex (isomerase/peptide)
Keywords: CHORISMATE PYRUVATEMUTASE, ALLOSTERIC PROTEIN, COMPLEX (ISOMERASE-PEPTIDE), TRANSITION STATE ANALOG, COMPLEX (ISOMERASE-PEPTIDE) complex
Deposited on 1997-07-14, released 1998-01-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chorismate mutase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32178 (0-255)
      • engineered (225)
    Domains in SCOPe 2.06: d5csma_
  • Heterogens: TRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5csmA (A:)
    mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
    dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
    yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
    kskdvegimknitnsaveekilerltkkaevygvdpterrierrispeylvkiykeivip
    itkeveveyllrrlee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5csmA (A:)
    mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
    dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
    yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
    kskdvegimknitnsaveekilerltkkaevygvdptrispeylvkiykeivipitkeve
    veyllrrlee