PDB entry 5cse

View 5cse on RCSB PDB site
Description: Streptavidin-S112Y-K121E Complexed with Palladium-Containing Biotin Ligand
Class: sugar binding protein
Keywords: suzukiase, artificial metalloenzymes, beta barrel, dimer, biotin, palladium, Biotin-binding protein, sugar binding protein
Deposited on 2015-07-23, released 2015-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-04, with a file datestamp of 2015-10-30.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (13-End)
      • expression tag (12)
      • engineered mutation (111)
      • engineered mutation (120)
    Domains in SCOPe 2.07: d5csea1, d5csea2
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (13-133)
      • expression tag (12)
      • engineered mutation (111)
      • engineered mutation (120)
    Domains in SCOPe 2.07: d5cseb1, d5cseb2
  • Heterogens: SVP, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cseA (A:)
    masmtggqqmgrdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgry
    dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltygtteanaw
    estlvghdtftkvkpsaasidaakkagvnngnpldavqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cseA (A:)
    deagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltygtteanawestlvghdtftk
    v
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cseB (B:)
    masmtggqqmgrdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgry
    dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltygtteanaw
    estlvghdtftkvkpsaasidaakkagvnngnpldavqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cseB (B:)
    deagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltygtteanawestlvghdtftk
    vk