PDB entry 5cru

View 5cru on RCSB PDB site
Description: Crystal structure of the Bro domain of HD-PTP
Class: protein transport
Keywords: HD-PTP, Bro domain, EGFR, PTP, PROTEIN TRANSPORT
Deposited on 2015-07-23, released 2016-02-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-02-24, with a file datestamp of 2016-02-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein phosphatase non-receptor type 23
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN23, KIAA1471
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5crua_
  • Chain 'B':
    Compound: tyrosine-protein phosphatase non-receptor type 23
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN23, KIAA1471
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5crub_
  • Chain 'C':
    Compound: tyrosine-protein phosphatase non-receptor type 23
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN23, KIAA1471
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5cruc_
  • Chain 'D':
    Compound: tyrosine-protein phosphatase non-receptor type 23
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN23, KIAA1471
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5crud_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cruA (A:)
    meavprmpmiwldlkeagdfhfqpavkkfvlknygenpeayneelkklellrqnavrvpr
    dfegcsvlrkylgqlhylqsrvpmgsgqeaavpvtwteifsgksvahedikyeqacilyn
    lgalhsmlgamdkrvseegmkvscthfqcaagafaylrehfpqaysvdmsrqiltlnvnl
    mlgqaqeclleksmldnrksflvarisaqvvdyykeacralenpdtasllgriqkdwkkl
    vqmkiyyfaavahlhmgkqaeeqqkfgervayfqsaldklneaiklakgqpdtvqdalrf
    tmdviggkynsakkdndfiyheavpaldtlqpvkgaplvkplpvnptdpavtgpdifakl
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cruA (A:)
    meavprmpmiwldlkeagdfhfqpavkkfvlknygenpeayneelkklellrqnavrvpr
    dfegcsvlrkylgqlhylqsrvpmgsgqeaavpvtwteifsgksvahedikyeqacilyn
    lgalhsmlgamdkrvseegmkvscthfqcaagafaylrehfpqaysvdmsrqiltlnvnl
    mlgqaqeclleksmldnrksflvarisaqvvdyykeacralenpdtasllgriqkdwkkl
    vqmkiyyfaavahlhmgkqaeeqqkfgervayfqsaldklneaiklakgqpdtvqdalrf
    tmdviggkynsakkdndfiyheavpaldtlqpvkgaplvkplpvnptdpavtgpdifakl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cruB (B:)
    meavprmpmiwldlkeagdfhfqpavkkfvlknygenpeayneelkklellrqnavrvpr
    dfegcsvlrkylgqlhylqsrvpmgsgqeaavpvtwteifsgksvahedikyeqacilyn
    lgalhsmlgamdkrvseegmkvscthfqcaagafaylrehfpqaysvdmsrqiltlnvnl
    mlgqaqeclleksmldnrksflvarisaqvvdyykeacralenpdtasllgriqkdwkkl
    vqmkiyyfaavahlhmgkqaeeqqkfgervayfqsaldklneaiklakgqpdtvqdalrf
    tmdviggkynsakkdndfiyheavpaldtlqpvkgaplvkplpvnptdpavtgpdifakl
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cruB (B:)
    meavprmpmiwldlkeagdfhfqpavkkfvlknygenpeayneelkklellrqnavrvpr
    dfegcsvlrkylgqlhylqsrvpmgsgqeaavpvtwteifsgksvahedikyeqacilyn
    lgalhsmlgamdkrvseegmkvscthfqcaagafaylrehfpqaysvdmsrqiltlnvnl
    mlgqaqeclleksmldnrksflvarisaqvvdyykeacralenpdtasllgriqkdwkkl
    vqmkiyyfaavahlhmgkqaeeqqkfgervayfqsaldklneaiklakgqpdtvqdalrf
    tmdviggkynsakkdndfiyheavpaldtlqpvkgaplvkplpvnptdpavtgpdif
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5cruC (C:)
    meavprmpmiwldlkeagdfhfqpavkkfvlknygenpeayneelkklellrqnavrvpr
    dfegcsvlrkylgqlhylqsrvpmgsgqeaavpvtwteifsgksvahedikyeqacilyn
    lgalhsmlgamdkrvseegmkvscthfqcaagafaylrehfpqaysvdmsrqiltlnvnl
    mlgqaqeclleksmldnrksflvarisaqvvdyykeacralenpdtasllgriqkdwkkl
    vqmkiyyfaavahlhmgkqaeeqqkfgervayfqsaldklneaiklakgqpdtvqdalrf
    tmdviggkynsakkdndfiyheavpaldtlqpvkgaplvkplpvnptdpavtgpdifakl
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cruC (C:)
    meavprmpmiwldlkeagdfhfqpavkkfvlknygenpeayneelkklellrqnavrvpr
    dfegcsvlrkylgqlhylqsrvpmgsgqeaavpvtwteifsgksvahedikyeqacilyn
    lgalhsmlgamdkrvseegmkvscthfqcaagafaylrehfpqaysvdmsrqiltlnvnl
    mlgqaqeclleksmldnrksflvarisaqvvdyykeacralenpdtasllgriqkdwkkl
    vqmkiyyfaavahlhmgkqaeeqqkfgervayfqsaldklneaiklakgqpdtvqdalrf
    tmdviggkynsakkdndfiyheavpaldtlqpvkgaplvkplpvnptdpavtgpdifakl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5cruD (D:)
    meavprmpmiwldlkeagdfhfqpavkkfvlknygenpeayneelkklellrqnavrvpr
    dfegcsvlrkylgqlhylqsrvpmgsgqeaavpvtwteifsgksvahedikyeqacilyn
    lgalhsmlgamdkrvseegmkvscthfqcaagafaylrehfpqaysvdmsrqiltlnvnl
    mlgqaqeclleksmldnrksflvarisaqvvdyykeacralenpdtasllgriqkdwkkl
    vqmkiyyfaavahlhmgkqaeeqqkfgervayfqsaldklneaiklakgqpdtvqdalrf
    tmdviggkynsakkdndfiyheavpaldtlqpvkgaplvkplpvnptdpavtgpdifakl
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cruD (D:)
    meavprmpmiwldlkeagdfhfqpavkkfvlknygenpeayneelkklellrqnavrvpr
    dfegcsvlrkylgqlhylqsrvpmgsgqeaavpvtwteifsgksvahedikyeqacilyn
    lgalhsmlgamdkrvseegmkvscthfqcaagafaylrehfpqaysvdmsrqiltlnvnl
    mlgqaqeclleksmldnrksflvarisaqvvdyykeacralenpdtasllgriqkdwkkl
    vqmkiyyfaavahlhmgkqaeeqqkfgervayfqsaldklneaiklakgqpdtvqdalrf
    tmdviggkynsakkdndfiyheavpaldtlqpvkgaplvkplpvnptdpavtgpdif